Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (2024)

1. Introduction

Whereas some catastrophic events such as Word War I and II are still vivid in our memories, most of us have forgotten that for close to 200 years (1096 to 1285), we Europeans pestered the Muslim world with the Crusades in the Holy Land. There was not just one crusade, but as many as eight, starting with that depreciable event of 27 November 1095 in Clermont when Pope Urban II was persuaded by a monk, Pierre d’Amiens, to open the flood of a series of aggressions in Palestine. There is a vast body of literature on the Crusades, which we have summarized in a list of 14 books [1,2,3,4,5,6,7,8,9,10,11,12,13,14] included in the Reference section (truly minimal, considering that J. Richard, in his book, dedicates 10 pages at the end of his treatise to catalog a much larger collection) [14].

Even if most of these events have fallen into oblivion, at least two major figures have remained in our collective memories, King Richard the Lionheart and his opponent, the “Ferocious” Saladin. There is a most curious story in Italy related to Saladin. In 1936, two companies, Perugina and Buitoni, launched a competition offering, as a prize, a Fiat 500 Topolino to anyone who could complete the collection of 150 lithographed color stamps, the premium one being the image of Saladin. The fact is that nobody could find this stamp, and this generated a stampede among the entire Italian population searching for the missing item and attempting any possible exchange among collectors. The search had become so paroxysmal that the fascist government, on 10 November 1937, via the Ministry of Corporation, decreed a total ban on any such collection. Meanwhile, a movie by Mario Bonnard, Il Feroce Saladino, appeared telling the story of a person who had found a catch of such stamps and had become filthy rich by selling them underground.

The events leading to a confrontation between the two leaders took place during the Third Crusade (1189–1192), in which the rulers of the three most powerful states of Western Christianity (England, France and the Holy Roman Empire) moved together to reconquer the Holy Land following the capture of Jerusalem by the Ayyubid sultan Saladin in 1187. It was partially successful, recapturing the important cities of Acre and Jaffa, and reversing most of Saladin’s conquests, but it failed to capture Jerusalem, which was the major aim of the Crusade and its religious focus. In April 1190, King Richard’s fleet departed from Dartmouth but reached Acre (that was already under siege by the Crusaders) on 8 June 1191. He immediately began supervising the construction of siege weapons to assault the city, which was captured on 12 July. After the seizure of Acre, King Richard decided to march to the city of Jaffa, since the control of this town was necessary before an attack on Jerusalem could be attempted. On 7 September 1191, however, Saladin attacked Richard’s army at Arsuf, 50 km north of Jaffa. Saladin attempted to harass Richard’s army into breaking its formation in order to defeat its isolated ranks. Richard maintained his army’s defensive formation, however, until the Hospitallers broke ranks to charge the right wing of Saladin’s forces. Richard then ordered a general counterattack, which won the battle. Arsuf was an important victory. The Muslim army lost 7000 soldiers. Arsuf dented Saladin’s reputation as an invincible warrior and proved Richard’s courage as a soldier and his skills as a commander.

Today, the site of Arsuf has been totally abandoned and hosts the ruins of a Crusader castle perched on a cliff overlooking the seashore. We visited this site and dug up plenty of pottery shards among which we could distinguish those of the Crusaders from those of the Ayyubid army. Extraction of food remnants and their proteomic analysis provided us important clues on the different diets of the two armies, as illustrated in this manuscript.

2. Materials and Methods

2.1. Samples

Crusaders’ pottery: ceramic glazed pottery fragments; ceramic pottery fragments; glass fragments (glassware produced in Apollonia glassmaking workshops; glassware fragments coated with golden leaf). Saladin’s warriors’ pottery: ceramic pottery fragments; terracotta pottery fragments. Samples of pottery fragments were obtained during the “Tel Baruch-Arsuf 2020 Climate change monitoring” expedition. The samples in the catalog of the expedition that were analyzed are from TA-17 to TA-211 (thus, the total number of samples we had available is 194).

2.2. Chemicals and Materials

Methanol (LC-MS Ultra CHROMASOLV, >99.9%), 2-propanol (LC-MS Ultra CHROMASOLV, >99.9%), acetic acid (eluent additive for LC-MS, >99.9%), ammonium bicarbonate (AMBIC), dithiothreitol (DTT), iodoacetamide, formic acid (FA, eluent additive for LC-MS, >99.9%), ammonium bicarbonate (AMBIC), trifluoroethanol (TFE) (>99%), ammonium hydroxide and water (LC-MS Ultra CHROMASOLV, >99.9%) were purchased from Sigma-Aldrich (Milwaukee, WI, USA). Microcon YM-5 and C18 Zip Tip pipette tips were from Millipore U.K. Limited. Trypsin was from Promega, USA. Acclaim PepMap C18 columns were from Thermo Scientific, USA. Ultrapure water was obtained through a Millipore Milli-Q system (Milford, CT, USA). The mixed-bed cation (SCX)/anion (SAX) exchange AG501 resin and C8 and C18 resins were from Bio-Rad (Hercules, CA, USA).

2.3. Synthesis and Characterization of the EVA Film

A special plastic-like film based on ethylene-vinyl acetate (EVA) as a binder of ground AG501 mix-bed cation/anion exchange and C8 and C18 resins (all from Bio-Rad) was prepared. A mixture was made comprising 70% 1–10 μm size ground beads and 30% EVA (the melting temperature was 75 °C). The proportion of the various resins in the plastic film was: 35% strong cation, 35% strong anion exchangers, 15% C8 and 15% C18 hydrophobic resins. The blend of melted EVA and Bio-Rad resins was poured in a "Brabender" mixer W30 and laminated via a "Brabender" extruder KE19 (both from Brabender GmbH, Duisburg, Germany) in the form of either a thin film or diskettes, having a thickness of 200 to 300 μm.

2.4. EVA Film Application

EVA films (width 50 mm, length 50 mm) were wetted in double distilled water prior to their applications to the surface of the specimens under investigation and then blotted on Whatman 3MM paper. They were placed on the pottery or glass test areas for 120 min while applying light pressure via a 100 g weight (but in difficult cases, the contact time was continued for a few days). All material harvested by the EVA thin diskettes was eluted and analyzed for proteins.

2.5. Mass Spectrometry Analysis for Protein Identifications

The dried eluates were suspended in 8 M urea, reduced by 5 mM DTT and alkylated by 15 mM iodoacetamide. The buffer was exchanged by a filter unit with a 5 kDa cut-off, using 50 mM AMBIC. The proteins were digested by 0.5 µg of trypsin, overnight at 37 °C. The peptide mixtures were purified by C18 pipette tips and analyzed by nLC MS/MS, using a MALDI TOF mass spectrometer (Voyager; ABI, Framingham, MA, USA) with the following settings: 25 kV accelerating voltage, 94.5% grid voltage and 350 ns delay. The peptides were separated, after trapping on a C18 pre-column, by using a gradient of 3–40% acetonitrile in 0.1% formic acid, over 50 min at a flow rate of 300 nL/min, at 40 °C. The separation system consisted of EASY-nLC. A solid ionic crystal MALDI matrix of paranitroaniline and butyric acid was used. The raw data were analyzed by Mascot (version 2.4.1) by consulting plant and animal protein databases. The peptide tolerance was 30 ppm. The false discovery rate was below 0.1%, using a decoy database, and the identified proteins contained at least 3 peptides.

2.6. Extraction and Sample Preparation Tools for Archeology Field Analysis

New tools for extracting biomolecules from fragments and fragments of various artifacts from archaeological horizons are sorely needed. In Apollonia, Arsuf and other places, there are huge archaeological layers (horizons) that come to the surface of the soil due its erosion. We have created several new tools based on EVA technology. The first instrument is an EVA probe. The probe can be thrust into an archaeological horizon (layer) that contains shards of utensils and extract proteins, peptides, salts and much more. The second tool is a special bag for archaeological material. Usually, archaeologists collect all their samples with archaeological fragments in bags. The soil from archeology horizons is kept in these special bags. In a bag with EVA inserts, the sample can be automatically extracted from the soil. This process is carried out from the soil already in this special bag. The third tool consists in tanks or flexible bags made with EVA inserts. In these tanks or bags, one can insert a shard of a dish or another sample for the extraction of biological molecules directly at the archaeological site.

2.7. Calorie Consumption and Diet Efficiency Estimations

To calculate the calorie content of diets, many online calculators for individual use have recently been created. In our study, different versions of nutritional calorie and value calculators were used, and an estimate of the effectiveness of the diets of the Crusaders and Saladin’s warriors was obtained: https://www.webmd.com/diet/healthtool-food-calorie-counter; https://www.mayoclinic.org/healthy-lifestyle/weight-loss/in-depth/calorie-calculator/itt-20402304 (accessed on 3 June 2021). However, we underline that it cannot be expected (and possible) that the calorie and nutritional calculators provided here as links could be used to estimate the effectiveness of the Crusaders’ and Saladin’s warriors’ diets, as it is impossible to determine the exact amounts and foods the warriors ate. We here add that the discussion of the diet of the two armies of two different religions is by no means only a scientific issue, but also a cultural and religious issue. Halalism among Muslims and different dietary variations among Saladin’s multinational Muslim army should be considered together with cultural and religious issues in the text of our report. The diet of the multinational Crusader army must also be considered in conjunction with cultural aspects. One of the warfare tactics was the supply of poisoned wine to the Christian troops. It is thus seen that the question of the diets of the two armies is a fairly complex issue.

3. Results

3.1. A Survey of the Territory

In order to understand the events, it is necessary to carry out a survey of the land. Figure 1 displays a map of the Middle East area where all crusades took place. The principalities of Armenian Cilicia and of Antioch, as well as the County of Tripoli, had already been established in the two previous crusades. The major events of the Third Crusade occurred mainly in the stretch of land between Tyre and Jerusalem.

Figure 2 shows the march to the south of the two armies. It should be noted that King Richard’s troops marched along the seashore, whereas the Saladin militia pursued them closely some five to ten kilometers inland, launching sporadic attacks along the route (marked by green arrows). Richard’s strategy was smart, since by following the seashore, he prevented attacks by the Muslims on two fronts. Moreover, and most importantly, he had given orders to a fleet to follow his army, so that every day they could obtain a fresh supply of food and fresh water. The fleet also had another important role: it acted as a traveling hospital taking aboard wounded soldiers, where they could be cured by physicians. The final confrontation between the two armies took place in a village called Arsuf (today known as Apollonia, a site some 10 miles from present-day Tel Aviv).

Figure 3 is an aerial view of the ruins of the Crusader castle in Arsuf, as it is standing today. The castle is perched on a cliff overlooking a ravine directly on the seashore. The site had been abandoned centuries ago, and the castle has never been restored. The locality is in an empty land with no modern settlements in the vicinity.

At the feet of the castle, close to the seashore, is the site which we excavated in search of pottery and fragments belonging to the epoch of the Third Crusade. We were led by experts to the archaeological horizon of this crusade, so we know for certain that the pottery we unearthed belongs to this period. Figure 4 shows a small part of the catch of pottery shards we recovered. The differences in manufacturing between the Crusader and Muslim pottery allowed us to sort out the two types of pottery. We used [15,16,17,18,19,20,21], for the selection and identification of Crusader and Muslim pottery. Additionally, we gathered information from public exhibitions in Israeli museums for identification of pottery to each period. In any event, in order to show, in better detail, the two types of pottery identified, we provide 12 photographs of Ayyubid and Crusader pottery fragments in two supplementary documents, with the understanding that these are just a small part of the 194 total samples examined. Sand and traces of earth were removed with fine brushes. After this cleaning treatment, we applied several EVA diskettes to the pottery surface and allowed the contact to continue for a minimum of two hours up to a few days, when needed (extraction of food remnants buried within the grains of the pottery turned out to be a lengthy process). Below follows the presentation of the food analysis of the two confronting armies. It should be noted that in all tables, only the proteins identified with a minimum of three peptides are listed. Moreover, in quite a few cases, proteins were identified with up to five peptides. Additionally, in some cases, identifications were obtained with very long peptide sequences. For example, in the case of cytochrome c oxidase subunit 1 (Table 2), peptide No. 2 contains a string of 45 amino acids.

3.2. A Clue on the Crusader Diet

Table 1 lists a series of fragments of goat milk proteins, while Table 2 provides a number of pig proteins. Table 3 displays the identified grape proteins, indicating the fact that the Crusaders also drunk wine, a beverage strictly forbidden among Muslims, as well as, of course, pig meat. Interestingly, we also found a few proteins from olives (Table 4), suggesting that the Crusaders also ate this fruit, and that they supplemented their diet with honey, as shown from the few protein fragments listed in Table 5.

3.3. A Clue on the Saracen Diet

It would appear that the main ingredients in the Muslim diet consisted mostly of cereals. Table 6 lists fragments of common wheat proteins, while Table 7 displays fragments of Triticum durum, and Table 8 catalogs Hordeum vulgare proteins. Table 9 codifies some fragments of sheep milk proteins.

3.4. A Common Foodstuff to Both Armies

Interestingly, in both types of pottery, we found traces of another type of food consumed by both armies, namely, sheep meat. In the case of Saladin’s troupes, sheep flocks were quite common in Palestinian land, and for Crusaders, sheep would likely come from the fertile planes of Cyprus. It is here underlined that these are our main findings and cannot possibly cover the entire range of aliments consumed by both armies. For instance, surely the Crusaders must have consumed cereals as well, at least in the form of bread. However, in this particular case, remnants of bread were not so traceable in their pottery. Table 10 lists the sheep proteins detected in pottery from both armies.

4. Discussion

4.1. Evaluation of our Extraction Procedure

Proteomics has been widely applied to detect and identify proteins on paleontological and archaeological artifacts. The widespread success of mass spectrometry in identifying ancient proteins has been, however, mostly limited to bones and other tissues (e.g., dental calculus) [22]. This is because these proteins are shielded and buried within a hydroxyapatite cage that protects them not only from external contamination but also from degradation caused by the environment. In pottery, these aspects are aggravated, first of all, due to the fact that considerably fewer proteins are adsorbed within the grains of ceramics, but also because they are much more exposed to external contaminants from the terrain and to degradation caused by soil bacteria. Yet, in recent years, data have been published demonstrating the possibility of extracting and identifying food residues buried in ancient pottery. Already in 2004, Guasch-Jané et al. [23] showed the identification of wine markers in ancient Egyptian vessels. Later on, Solazzo et al. [24] and Dallongeville et al. [25] produced evidence on the presence of proteins in potsherds and ancient amphorae. The processing of dietary cereals was assessed by Hammann et al. [26] in archaeological pottery via the presence of absorbed lipid biomarkers, while Hendy et al. [27] and Tanasi et al. [28] extracted food residues even from prehistoric pottery. A comparison between this last report and our data is worth commenting upon. In order to obtain sufficient material from the food traces remaining in these very ancient vessels, the ceramic fragments were ground using an agate mortar and pestle until an impalpable powder was obtained. The organic material was extracted under two different conditions: in one case at pH = 2 (0.1% of trifluoroacetic acid and 4% sodium-dodecyl-sulphate solution, SDS) for 30 min at 95 °C; in the second case in alkaline reducing conditions, pH = 8.5 (4% SDS, 100 mM Tris/HCl and 0.1 M dithiothreitol) for 30 min at 95 °C. Our strategy was completely different. The cleaned pottery fragments were overlaid with humidified EVA diskettes, and extraction was allowed to proceed for up to one week. This is certainly a longer time but leaves the ceramic material intact. Obviously, destruction of samples is allowed in the case of pottery shards, but if one had to go to museums and attempt an extraction on the most valuable items, only our technology would be allowed, of course, since it is non-damaging and non-contaminating.

Among the food remnants we identified, it might sound surprising that there could be traces of pork meat in a Muslim territory where no such animals were tolerated and no such food could be eaten. Yet, historical records [14] explain the mystery: in preparation of the Crusades, the king’s functionaries had collected huge quantities of cheese from Essex, dry legumes (mostly peas and broad beans) from Kent and Cambridge and in excess of 14,000 pigs from the counties of Hampshire, Essex and Lincoln. The pigs were slaughtered, chopped to pieces and dried and salted. In addition to that, they hoarded huge amounts of wheat grains (for preparing bread locally while waging war) as well as a large supply of barrels of wine. Therefore, a supply of this food was available to the Crusaders. Were this not enough, the king took care of transportation too: he ordered the construction (and/or acquisition) of 100 ships as well as 14 large “busses” (fishing boats). Additionally, on his way to the Holy Land, King Richard had conquered the island of Cyprus, a precious territory that could supply plenty of foodstuffs to his army.

4.2. A Closer Survey of the Arsuf Battle

It was not uncommon during the previous two crusades, as well as in the following ones, that entire garrisons, villages and even fortified towns had to surrender for lack of food and, even more pressing, for lack of water, a critical supply in these territories surrounded by deserts. King Richard was a shrewd leader and was well aware of these problems. That is why, after carrying out the siege and capture of Acre, when moving south to conquer Jerusalem, he decided to march along the coastline while being escorted by an entire fleet, providing the much-needed supply of foodstuffs and negating the possibility of being attacked by the Muslim army on the right side of his marching column.

The confrontation in Arsuf was indeed quite harsh. A vivid account of the skirmishes and final confrontation was provided by Geoffrey de Vinsauf (in Latin prose) in the thirteenth century, shortly after the death of King Richard [29]. We offer here some excerpta as rendered in a more readable English prose by Thomas Bulfinch [30]. Marching order: King Richard, most experienced in military affairs, divided the army into twelve companies, and these again into five divisions, marshalled according to strict military discipline. Therefore, in order to prevent the invasion of Saracens within his marching soldiers, they were “kept together so closely that an apple, if thrown, would not have fallen to the ground without touching a man or a horse”. Additionally, King Richard and the Duke of Burgundy, with a chosen retinue of warriors, rode up and down the stretched marching line, narrowly monitoring the chasing Turks as well as their own troops. Here is how the frequent harassing attacks of the Saracens on the Crusaders marching south were conducted. To start with, they were stunned by “military bands” playing “clarions and trumpets; some had horns, others had pipes and timbrels, gongs, cymbals, and other instruments, producing a horrible noise and clamour”. Then, the enemy came rushing down, like a torrent, to the attack: “it rained darts; the air was filled with the shower of arrows, and the brightness of the sun was obscured by the multitude of missiles, as if it had been darkened by a fall of winter’s hail or snow”. The distress of Crusaders is narrated with eloquence by Geoffrey de Vinsauf: “In truth our people, so few in number, were so hemmed in by the multitudes of the Saracens, that they had no means of escape, if they tried; neither did they seem to have valour sufficient to withstand so many foes, nay, they were shut in like a flock of sheep in the jaws of wolves, with nothing but the sky above, and the enemy all around them”. Yet, when reaching Arsuf and the battle took a violent turn, the deeds of King Richard were so striking that his marksmanship became legendary: “There the king, the fierce, the extraordinary king, cut down the Turks in every direction, and none could escape the force of his arm, for wherever he turned, brandishing his sword, he carved a wide path for himself; and as he advanced he gave repeated strokes with his sword, cutting them down like a reaper with his sickle”. At the highest pitch of the battle, Richard’s exploits took an even more vehement turn: “the king, mounted on a bay Cyprian steed, which had not its match, bounded forward in the direction of the mountains, and scattered those he met on all sides; for the enemy fled from his sword and gave way, while helmets tottered beneath it, and sparks flew forth from its strokes”. One wonders if there is some exaggeration taken from the ballads of King Arthur, and the “chevaliers de la table ronde” may even be from the Chanson de Roland. At the end of the day, the Christians counted seven thousand Saracens slain and only one tenth in their files missing.

4.3. Evaluation of the Crusades over the Centuries

All throughout Europe, the Crusades were valued positively for centuries. It cannot be forgotten that Muslims had invaded the south of Europe already during the reign of Charlemagne, an expansion that he was not quite successful in contrasting. In fact, it was only during the reign of Isabelle of Castille that the Moors were evicted from Spain in 1492. During the Renaissance, the epos of the Crusades peaked, and entire poems were composed in their celebration. For instance, Orlando Furioso by Ludovico Ariosto deals, in grand part, with conflicts between the Christian and Muslim worlds. One of the Saracens kings, Rodomonte, during the siege of Paris, manages to climb the ramparts of the city and wreck havoc among the Christians, rudely cutting to pieces the inhabitants much in the same way as King Richard valiantly fought in Arsuf (canto XIV, octets 113–125). La Gerusalemme Liberata by Torquato Tasso should also be mentioned, which is entirely devoted to the Crusades. It starts, in fact, with Godfrey of Bouillon leaving France for Jerusalem and ends (canto XX) with a final battle between the Muslims and the Crusaders, with the victory of the latter army and the liberation of the Holy Sepulchre. It cannot also be forgotten that the Turks kept threatening the borders of Europe for centuries, with continuous clashes that peaked with the Battle of Lepanto (7 October 1571), a tremendous skirmish between the 210 galleons of European forces and the more than 300 vessels of the Muslim fleet. The Christianity victory kept the Muslim world at bay for centuries after.

The first hole in the wall was bored by the two encyclopedists, Diderot and D’Alembert, who stated: “des temps de ténebres assez profondes, & d’un étourdissem*nt assez grand […] pour entraîner une partie du monde dans une malheureuse petite contrée, afin d’en égorger les habitans, & de s’emparer d’une pointe de rocher qui ne valoit pas une goutte de sang” (“a time of such a deep darkness and of such extreme excitement […] as to drag a part of the word in an unlucky, small country just to slit the throat to their inhabitants and take over a rocky peak that was not worth a drop of blood”) [31]. Imagine if Voltaire would lag behind: “an epidemic folly that lasted more than 200 years, and was distinguished by any possible cruelty, wickedness, intemperance, madness of which the human kind would be capable” [32]. In the nineteenth century, an epoch of romanticism, this criticism was ignored, though. In fact, the Crusaders were shrouded in a mystic halo. The situation was reversed in the twentieth–twenty-first centuries, also due to the fact that it was in this period that most of the books on the Crusades were written [1,2,3,4,5,6,7,8,9,10,11,12,13,14]. For instance, Sir James Cochran Stevenson Runciman [4], author of a classic trilogy on the Crusades, expressed a strong criticism. According to him: “High ideals were besmirched by cruelty and greed, enterprise and endurance by a blind and narrow self-righteousness, and the holy war itself was nothing more than a long act of intolerance in the name of God, which is a sin against the holy ghost". He underlined that the Crusades were the last of the barbarian invasions; their disaster was their failure to understand Byzantium. Needless to say, on the Internet, one can find plenty of documents in full support of the Crusades, thus leaving the debate fully open.

5. Conclusions

Based on the data here presented, we suggest that the Crusaders’ diet (low-carbohydrate, high-protein consumption, as opposed to the Muslims’ diet, high in carbohydrates) might have helped them in battle since this diet is more energetic and maintains the body slim and supple. That being said, perhaps King Richard’s troop might have anticipated what became popular in this century as the Atkins diet, popularized by this physician in a book published in 1972 [33]. Of course, this is a mere hypothesis and, in any event, does not cancel the very first requirements in battles, namely, shrewdness of leaders, and soldiers’ equipment and willingness to fight, all of them being the main ingredients of a victory.

It is not the aim of the present investigation to issue a moral judgment on the Crusades, which we leave to historians. We just want to dedicate our humble work to these two unique, memorable figures, King Richard I and his opponent, the equally noble and shrewd leader, the sultan Salah ad-Din. We are pleased to state that Dante places him in the Canto IV of the Inferno, but in a special place called Limbo (a location of lenience for those who had no access to Christianity). He is placed in a castle of the “Spiriti Magni” (Noble Souls), an inaccessible fortified compound enclosed within seven walls:

Vidi quell Bruto che cacciò Tarquinio,

Lucrezia, Iulia, Marzia e Corniglia;

E solo, in parte, vidi ‘l Saladino

(Verses 127–129). Not a bad place to be in!

Post-Scriptum

We are pleased to mention here a paper by Charlier et al. [34] on the analysis of the embalmed King Richard heart, discovered in a casket buried in the Notre Dame cathedral in Rouen. They found that the heart was wrapped in linen, associated with myrtle, daisy, mint, frankincense, creosote, mercury and lime. They noted, additionally, that the goal of using such preservation materials was not only to allow long-term conservation of the tissues but also a good scent similar to the one of Christ’s burial (comparable to the bouquet of sanctity). Additionally, upon a request of one referee, we added a few more references to the poems here quoted [35,36].

Supplementary Materials

The following are available online athttps://www.mdpi.com/article/10.3390/heritage4040188/s1, Figure S1: Ayyubid pottery, Figure S2: Crusaderspottery.

Author Contributions

Project administration, S.Z.; methodology, G.Z.; writing—review and editing, P.G.R. All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding.

Conflicts of Interest

The authors declare no competing financial interests.

References

  1. Barber, M. The Crusader States; Yale University Press: New Haven, CT, USA, 2012. [Google Scholar]
  2. Hindley, G. Saladin: Hero of Islam; Pen & Sword Military: Barnsley, UK, 2007. [Google Scholar]
  3. Hill, P. The Knights Templar at War. 1120–1312; Pen & Sword Military: Barnsley, UK, 2018. [Google Scholar]
  4. Runciman, S. A History of the Crusades 1: The First Crusade and the Foundation of the Kingdom of Jerusalem/Angla; Penguin Books: Westminster, UK, 2016. [Google Scholar]
  5. Riley-Smith, J. The Crusades: A History; Bloomsbury Academic: London, UK, 2014. [Google Scholar]
  6. Dossa, S.; Maalouf, A. The crusades through arab eyes. MERIP Middle East Rep. 1986, 42, 36–38. [Google Scholar] [CrossRef]
  7. Jones, T.; Ereira, A. Crusades; Penguin Group USA: New York, NY, USA, 1999. [Google Scholar]
  8. Bradford, E. The Great Betrayal; Open Road Media: New York, NY, USA, 2014. [Google Scholar]
  9. France, J. The Crusades and the Expansion of Catholic Christendom, 1000–1714; Routledge: Oxford, UK, 2006. [Google Scholar]
  10. Madden, T.F. The Crusades Controversy: Setting the Record Straight; North Palm Beach: Wellspring, UK, 2017. [Google Scholar]
  11. Jones, D. Crusaders: The Epic History of the Wars for the Holy Lands; Penguin Books: Westminster, UK, 2019. [Google Scholar]
  12. Stark, R. God’s Battalions: The Case for the Crusades; HarperOne: San Francisco, CA, USA, 2009. [Google Scholar]
  13. Carole, H. The Crusades Islam Perspectives; Endinburgh University Press: Edinburgh, UK, 1999. [Google Scholar]
  14. Richard, J. Histoire de Croisades; Fayard: Paris, France, 1996. [Google Scholar]
  15. Pines, M.; Sapir-Hen, L.; Tal, O. Crusader diet in times of war and peace: Arsur (Israel) as a case study. Oxf. J. Archaeol. 2017, 36, 307–328. [Google Scholar] [CrossRef]
  16. Pines, M.; Sapir-Hen, L.; Tal, O. Consumption and disposal practices in the southern levant in late antiquity: Animal bones from ’Aπολλωνία/Σώζουσα’s hinterland as a case study. Zeitschrift Deutschen Palästina Vereins 2017, 133, 186–204. [Google Scholar]
  17. Raphael, K.; Tepper, Y. The archaeological evidence from the mamluk siege of arsuf. Mamluk Stud. Rev. 2005, 9, 85–100. [Google Scholar]
  18. Roll, I. Medieval apollonia-arsuf: A Fortified coastal town in the levant of the early muslim and crusader periods. In Autour de la première Croisade. Actes du Colloque de la Society for the Study of the Crusades and the Latin East (Clermont-Ferrand, 22–25 juin 1995); Publications de la Sorbonne: Paris, France, 1996; pp. 597–606. [Google Scholar]
  19. Roll, I.; Ayalon, E. The market street at Apollonia-Arsuf. Bull. Am. Sch. Orient. Res. 1987, 267, 61–76. [Google Scholar] [CrossRef]
  20. Roll, I.; Yohana, H.; Tepper, Y.; Harpak, T. Apollonia-Arsuf during the crusader period in light of new discoveries. Qadmoniot 2000, 33, 18–31. (In Hebrew) [Google Scholar]
  21. Sapir-Hen, L.; Pines, M.; Tal, O. Animal economy and social diversity in Byzantine Apollonia/Sozousa. Levant 2014, 46, 371–381. [Google Scholar] [CrossRef]
  22. Dallongeville, S.; Garnier, N.; Rolando, C.; Tokarski, C. Proteins in art, archaeology, and paleontology: From detection to identification. Chem. Rev. 2016, 116, 2–79. [Google Scholar] [CrossRef] [PubMed]
  23. Guasch-Jané, M.R.; Ibern-Gómez, M.; Andres-Lacueva, C.; Jáuregui, O.; Lamuela-Raventos, R.M. Liquid chromatography with mass spectrometry in tandem mode applied for the identification of wine markers in residues from ancient egyptian vessels. Anal. Chem. 2004, 76, 1672–1677. [Google Scholar] [CrossRef] [PubMed]
  24. Solazzo, C.; Fitzhugh, W.W.; Rolando, C.; Tokarski, C. Identification of protein remains in archaeological potsherds by pro-teomics. Anal. Chem. 2008, 80, 4590–4597. [Google Scholar] [CrossRef] [PubMed]
  25. Dallongeville, S.; Garnier, N.; Casasola, D.B.; Bonifay, M.; Rolando, C.; Tokarski, C. Dealing with the identification of protein species in ancient amphorae. Anal. Bioanal. Chem. 2010, 399, 3053–3063. [Google Scholar] [CrossRef] [PubMed]
  26. Hammann, S.; Cramp, L.J.E. Towards the detection of dietary cereal processing through absorbed lipid biomarkers in archaeological pottery. J. Archeol. Sci. 2018, 93, 74–81. [Google Scholar] [CrossRef]
  27. Hendy, J.; Colonese, A.C.; Franz, I.; Fernandes, R.; Fischer, R.; Orton, D.; Lucquin, A.; Spindler, L.; Anvari, J.; Stroud, E.; et al. Ancient proteins from ceramic vessels at Çatalhöyük West reveal the hidden cuisine of early farmers. Nature Commun. 2018, 9, 4064–4073. [Google Scholar] [CrossRef] [PubMed]
  28. Tanasi, D.; Cucina, A.; Cunsolo, V.; Saletti, R.; Di Francesco, A.; Greco, E.; Foti, S. Paleoproteomic profiling of organic residues on prehistoric pottery from Malta. Amino Acids 2021, 53, 295–312. [Google Scholar] [CrossRef] [PubMed]
  29. William, S. Itinerarium Peregrinorum et Gesta Regis Ricardi; Eyre & Spottiswoode: London, UK, 1864. [Google Scholar]
  30. Bulfinch, T. The Age of Chivalry; Reprinted by Dover Publications, 2012; Crosby, Nichols: Boston, MA, USA, 1859. [Google Scholar]
  31. Diderot, D.; D’Alembert, J.B. L’Encyclopédie, 1st ed.; Le Breton: Paris, France, 1751; Volume 4, pp. 502–505. [Google Scholar]
  32. Arouet, F.M. Essai sur les Mœurs et ! Esprit des Nations; Cramer: Paris, France, 1756. [Google Scholar]
  33. Atkins, R.C. Dr. Atkins New Diet Revolution: Revised and Improved; HarperCollins: New York, NY, USA, 2001. [Google Scholar]
  34. Charlier, P.; Poupon, J.; Jeannel, G.-F.; Favier, D.; Popescu, S.-M.; Weil, R.J.; Moulherat, C.; Huynh-Charlier, I.; Dorion-Peyronnet, C.; Lazar, A.-M.; et al. The embalmed heart of Richard the Lionheart (1199 A.D.): A biological and anthropological analysis. Sci. Rep. 2013, 3, 1296. [Google Scholar] [CrossRef]
  35. Ariosto, L. Orlando Furioso; Francesco Libri: Ferrara, Italy, 1516. [Google Scholar]
  36. Tasso, T. Gerusalemme Liberata; Cavalcalupo: Venezia, Italy, 1581. [Google Scholar]

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (1)

Figure 1.Map of Near East in 1190 at the time of the Third Crusade.

Figure 1.Map of Near East in 1190 at the time of the Third Crusade.

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (2)

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (3)

Figure 2.Scheme of the march of King Richard’s troops towards Jaffa, followed by his fleet and the pursuit of Saladin’s army.

Figure 2.Scheme of the march of King Richard’s troops towards Jaffa, followed by his fleet and the pursuit of Saladin’s army.

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (4)

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (5)

Figure 3.Aerial view of the ruins of Arsuf castle (today Apollonia).

Figure 3.Aerial view of the ruins of Arsuf castle (today Apollonia).

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (6)

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (7)

Figure 4.Part of the pottery shards dug out from the Arsuf archaeological site.

Figure 4.Part of the pottery shards dug out from the Arsuf archaeological site.

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (8)

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (9)

Table 1.Fragments of goat milk proteins.

Table 1.Fragments of goat milk proteins.

Accession NumbersProtein NameMascot ScoreMrSequencesNo. Peptides
P02670Kappa-CN22521,441(1) MMKSFFLVVTILALTLPFLGAQEQNQEQPICCEK
(2) MAIPPKKDQDK
(3) LSRYPSYG LNYYQQRPVA LINNQFLPYP YYAKPVAVR
3
P02756Beta-lactoglobulin34119,976(1) LEKFDKALKA LPMHIR
(2) LLFCMENSAEPEQSLACQCLVRTPEVDK
(3) LACGIQAIIVTQTMKGLDIQK
3
A0A5K6WAG1Kappa-casein76421,455(1) VALINNQFLPYPYYAKPVAVR
(2) VPAKSCQDQPTTLAR
(3) QEQNQEQPICCEKDERFFDDKIAK
(4) QPTTLARHPHPHLSFMAIP PK
4
P33048Beta-casein29024,865(1) LGPVR
(2) LQPEIMGVPKVKETMVPK HKEMPFPKYPVEPFTESQSL TLTDVEK
(3) MFPPQSVLSLSQPKVLPVPQK
(4) QPEIMGVPKVK
4
P85295Albumin19210,055(1) DTHKS
(2) DLGRHPEYAVS
(3) VSVLLR
(4) VRXXXKAPQVSTPTLVEISR
(5) QTALVELLK
5
W5VVI0Cathelicidin-13659799(1) DITCNNHQS
(2) FKENGLLKRCEGT VTLDQVR
(3) QCDFKENGLLK
3
P18626Alpha-S1-casein26924,290(1) MEDAKQMKAGSS SSSEEIVPNSAEQK
(2) LLRLKKYNVPQLEIVPKS AEEQLHSMK
(3) MKAGSSSSSEEIVPNS AEQKYIQK
3
P33049Alpha-S2-casein19926,389(1) MKFFIFTCLLAVALAK
(2) MAIHPRKEK
(3) LNPWDQVK
(4) LTEEEKNRLNFLKKISQYYQK
4

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (10)

Table 2.Fragments of pig proteins.

Table 2.Fragments of pig proteins.

Accession NumbersProtein NameMascot ScoreMrSequencesNo. Peptides
P16293Coagulation factor IX34245,516(1) MDYENSTEVEPILDSL TESNQSSDDFIRIVGGENAK
(2) QYLKVPLVDRATCLR STK
(3) FSNMDYENSTEVEPILDSLTESNQSSDDFIR
3
P24964Cytochrome b20142,782(1) LHANGASMFFICLFIHVGR
(2) LILMPMLHTSK
(3) MFFICLFIHVGR
3
O79876cytochrome c oxidase subunit 140856,958(1) LYLLFGAWAGMVGTALSLLIR
(2) QIYNVIVTAHAFVMIFFMV MPIMIGGFGNWLVPLMIGAP DMAFPR
(3) LVPLMIGAPDMAFPR
3
P02189Myoglobin23017,085(1) LSDGEWQLVLNVWGKVEA DVAGHGQEVLIR
(2) LKKHGNTVLTALGGILKKK
(3) LTALGGILKKKGHHEAELTPL AQSHATK
3
Q29548Beta-hexosaminidase subunit beta54261,050(1) LQVHVESECDTFPSISSNESYVLHVK
(2) QFMQEK
(3) QSINFGVLSSK
3
Q29016Acrosin-binding protein21360,827(1) MRQLAAGSLL SLLKVLLLPL APAPAQDANSASTPGSPLSPTEYER
(2) LNNNVEELLQSSLSLGGQE QGQEHK
(3) QSEFVSSNPFSFTPRVRE VESTPMMMENIQELIR
(4) VASWLQTEFLSFQDGDFPT KICDTEYVQYPNYCAFKSQQ CMMR
4
A0A5G2QQE9Collagen type I alpha 1 chain277140,883(1) MGPRGPPGPPGKNGDDG EAGKPGR
(2) QAGVMGFPGPKGAAGEPGK
(3) LPGAKGLTGSPGSPGPDGK
3
Q29218Keratin, type I cytoskeletal 2067812,528(1) QIQDLRNQIRDAQLQNARCV LQIDNAKLAAEDFRLK
(2) MTMKNLNDRLASYLEK
(3) QSNSKFELQIK
3

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (11)

Table 3.Fragments of grape proteins.

Table 3.Fragments of grape proteins.

Accession NumbersProtein NameMascot ScoreMrSequencesNo. Peptides
Q6PWU2(-)-alpha-terpineol synthase59068,883(1) MALSMLSSIP NLITHTRLPIIIK
(2) MEQARDFAHRHLGKGLEQN IDQNLAIEVK
(3) MVQATHQEDLRHMSSWWSSTRLGEK
3
A5C7X2Cytochrome P450 CYP76Y248255,742(1) MPLILCFFLLQFLRPSSHATKLPPGPTGLPILGSLLEIGK
(2) MFRRFDLLGVK
(3) MQEQCGATLKK
(4) MEGAGKFNISDYFPMFRRFDLLGVKRDTFSCYK
4
Q8S4W7DELLA protein GAI167364,866(1) MKREYHHPHHPTCSTSPTGKGK
(2) MWDADPQQDAGMDELLAVLGYNVK
(3) VAVNSVFELHSLLARPGGER
(4) VGWKLAQLAETIHVEFEYR
4
A8VPW4MYBC2-L1 protein23025,255(1) VKNYWNSHLRRKLINMGIDPNNHRLSHNFPR
(2) VKSVGDNDQTSDAGS CLDDNR
(3) QDTNKGAWSKQEDQKLIDYIRK
3

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (12)

Table 4.Fragments of olive proteins.

Table 4.Fragments of olive proteins.

Accession NumbersProtein NameMascot ScoreMrSequencesNo. Peptides
E3SU11Thaumatin-like protein45824,727(1) VSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGGGR
(2) VFNTNEYCCTNGPGSCGPTPLSR
(3) FALNQPNNLDFVDISNVDGFNIPLEFSPTTNVCR
3
A0A1D6ZNQ5Acyl-[acyl-carrier-protein] desaturase51144,622(1) VAQRLGVYTAKDYADILEFLVGRWDVEKLTGLSGEGR
(2) FQERATFISHGNTAR
(3) VEKLFEIDPDGTVLALADMMR
(4) VYTAKDYADILEFLVGRWDVEKLTGLSGEGR
4
E3NYV3Lipoxygenase297101,717(1) VDKSYLPSNTPSGLKI YREKELQILRGDGTGERKTFER
(2) VELPKQKSTGFLANIIPR
(3) VEKNVLLFETPQLYER
(4) VSHWLR
(5) VIATNRQLSAMHPVYKLHPHLR
5

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (13)

Table 5.Fragments of honey proteins.

Table 5.Fragments of honey proteins.

Accession NumbersProtein NameMascot ScoreMrSequencesNo. Peptides
P01501Melittin3427585(1) VLTTGLPALISWIKR
(2) MVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLK
(3) LTTGLPALISWIKR
3
O18330Major royal jelly protein 121148,886(1) VSKSGVLFFGLVGDSLGCWNEHRTLER
(2) VCQGTTGNILR
(3) LPILHEWKFFDYDFGSDER
(4) LSPMTNNLYYSPVASTSLYYVNTEQFR
4

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (14)

Table 6.Fragments of common wheat proteins.

Table 6.Fragments of common wheat proteins.

Accession NumbersProtein NameMascot ScoreMrSequencesNo. Peptides
P17314Alpha-amylase/trypsin inhibitor CM312318,221(1) MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFR
(2) LPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCR
(3) LYCCQELAEISQQCRCEALR
3
Q10464Puroindoline-B22116,792(1) LFLLALLALVASTTFAQYSEVGGWYNEVGGGGGSQQCPQERPK
(2) QERPK
(3) VIQGRLG GFLGIWRGEVFKQLQR
(4) LFLLALLALVASTTFAQYSEVGGWYNE VGGGGGSQQCPQER
4
P82900Non-specific lipid-transfer protein 2G2919832(1) QGCFCQYAKD
(2) LRAQQGCFCQYAKPTYGQYIR
(3) QYAKDPTYGQYIR
3
P01544Alpha-1-purothionin65213,526(1) LALESNSDEPDTIEYCN
(2) LGCRLCRARGAQKLCAGVCRCK
(3) QLQVEGKSCCRSTLGRNCYNLCR
3
P10388Glutenin high molecular mass subunit29990,293(1) QVSYYPGQASPQR
(2) QLRDISPECHPVVVSPVAGQYEQQIVPK
(3) LQQPAQGQQGQQLAQGQQGQQPAQVQQGQR
3
A0A3B6C437Beta-amylase33167,919(1) LEEDFRAAATDAGHPEWELPDDAGEYNDAPDDTR
(2) LAAKVSGIHWWYR
(3) LDGRDGYRPIAR
(4) LARHDGAVLNFTCAEMR
4
P01543Purothionin A-144114,625(1) LCANVCR
(2) LSCPKDPKLVLESNSDEPDTMEYCNLGCR
(3) LVLEQVQVEGKSCCK
(4) LVLESNSD EPDTMEYCNLGCR
4
P17314Alpha-amylase/trypsin inhibitor22618,221(1) LPEWMTSASIYSPGKPYLAK
(2) LIDLPGCPREMQWDFVR
(3) LPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVR
3
P83207Chymotrypsin inhibitor27012,944(1) QPPLAPRCPTEVKR
(2) LQGCHYYVTSQTCGFVPLLPIEVMK
(3) QGCHYYVTSQTCGFVPLLPIEVM KDRCCR
3
P93692Serpin-Z2B37842,981(1) QYIS SSDGLKVLKLPYKQGGDK
(2) LIKDILPAGSIDNTTR
(3) QLAATLGEGEVEGLHALAEQVVQFVLADASNIGGPR
3
P01084Alpha-amylase inhibitor49713,185(1) VPALPGCRPLKLQCNG SQVPEAVLR
(2) LYSMLDSMYK
(3) QAFQVPALPGCRPLLKLQCNGSQVPEAVLR
3

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (15)

Table 7.Fragments of Triticum durum proteins.

Table 7.Fragments of Triticum durum proteins.

Accession NumbersProtein NameMascot ScoreMrSequencesNo. Peptides
A0A446NJU5Ribokinase23436,611(1) LEARLRLPLAGPTPATAFLSGSNPK
(2) LDLIRQAGVLLLQR
(3) QNSIIIVGGANMEGWAPEVDQEDLDLIR
3
A0A446KRB8UMP-CMP kinase21126,949(1) LIDGFPRNE ENRAAFENVTK
(2) LIKTTIFVFPTIRIVLQGR
(3) LMFGLCILIK
3
A0A446WFI0NAD(P)H-hydrate epimerase23153,127(1) LIICGPGNNGGDGLVAAR
(2) LTAPKLCAKKFTGPHHFLGGRFVPPPISSK
(3) LTTVNKAGKPSSRMVLLKGVDK
3
A0A446K973Flap endonuclease 140242,744(1) LQGMFSRTIRLLEAGI KPVYVFDGKPPEMKK
(2) LENINKDKYQIPEDWPYQEARRMFKEPDVTLDIPELK
(3) QHGSIEGILENINKDKYQ IPEDWPYQEAR
3
A0A446X1P5ATP-dependent 6-phosphofructokinase47850,586(1) LKVAVAGIPKTIDNDIPVIDK
(2) LAHSVVHGAMAGYTGFTVGQVNGR
(3) LSSTNQPSFLSKQDVDDAVEDER
3

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (16)

Table 8.Fragments of Hordeum vulgare proteins.

Table 8.Fragments of Hordeum vulgare proteins.

Accession NumbersProtein NameMascot ScoreMrSequencesNo. Peptides
P82993Beta-amylase30859,639(1) VNIPIPQWVRDVGTRDPDIFYTDGHGTR
(2) MEVNVK
(3) MLPLDAVSVNNRFEKGDELRAQLRK
(4) QAMSAPEELVQQVLSAGWR
4
P45850Oxalate oxidase 121121,203(1) VSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALR
(2) VAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPR
(3) QNPGIVFVPLTLFGSDPPIPTPVLTKALR
3
P27337Peroxidase 120132,976(1) VSCADILTVAARDSVVALGGPSWTVPLGRR
(2) VQGCDASVLLSGMEQNAIPNAGSLR
(3) QGQIRLSCSR
3
P55307Catalase isozyme 130956,586(1) VRFSTVVHERGSPETLRDPRGFAVKFYTR
(2) VHAFKPSPKTNMQENWRVVDFFSHHPESLHMFTFLF DDVGIPLNYR
(3) VNAPKCAHHNNHHDGLMNFIHR
(4) VSQLTCADFLR
4
F2CTM5Ribokinase26637,073(1) VEVNRLPLVGETVAASAGHSLAGGKGANQAACGGR
(2) VALVEGKPKKECMRFAAAAASLCVRVKGAIPSMPDR
(3) VPVLDAGGMDAPVPRELLELVDIFSPNETELAR
3

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (17)

Table 9.Fragments of sheep milk proteins.

Table 9.Fragments of sheep milk proteins.

Accession NumbersProtein NameMascot ScoreMrSequencesNo. Peptides
P21814Uterine milk protein26549,223(1) QPNLTQKEDFF LNDKTKVQVDMMRK
(2) VHLGRELVKQKQLR
(3) QIRKLQKMDIQMIDFSDTEKAKKAISHHVAEKTHTKIR
3
R9WQI9Prolactin39025,778(1) VLMSLILGLLRSWNDPLYHLVTEVR
(2) FGQVIPGAKETEPYPVW SGLPSLQTKDEDAR
(3) VMVSHYIHNLSSEMFNEFDKR
3
C7DLN1Fatty acid synthase2419,232(1) VEDAFRYMAQGKHIGKVVIQVREEER
(2) VTFHGILLDALFEENSTMWQEVSSLLKAGIREGVVQPLKR
(3) QVEDAFRYMAQGKHIGK VVIQVR
3
P04654Alpha-s2-casein32226,332(1) VFTKKTKLTEEEKNR
(2) MKFFIFTCLLAVALAKHKMEHVSSSEEPINISQEIYKQEK
(3) QKFPQYLQYLYQGPIVLNPWDQVKR
3

Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (18)

Table 10.Fragments of sheep proteins.

Table 10.Fragments of sheep proteins.

Accession NumbersProtein NameMascot ScoreMrSequencesNo. Peptides
Q29524Lipoprotein lipase20753,588(1) VIAERGLGDVDQLVKCSHERSVHLFIDSLLNEENPSKAYR
(2) VRAKRSSKMYLKTR
(3) VIFVKCHDKSLNR
3
P67930Somatotropin38624,631(1) VTPRAGQILKQTYDKFDTNMR
(2) VFTNSLVFGTSDR
(3) QILKQTYDKFDTNMR
3
Q8SQG7Hyaluronidase-226554,229(1) VHLEMLKGHVEHYIRTQEPAGLAVIDWEDWR
(2) VYLEETLASSTHGRNFVSFRVQEALR
(3) VADVHHANHALPVYVFTR
(4) MDLISTIGES AALGAAGVIL WGDAGFTTSNETCRRLK
(5) VASHHPDWPPERIVKEAQYEFEFAAR
5
P56591Cytochrome P450 1A149759,230(1) VANVICAICFGRR
(2) VFVNQWQINHDQKLWEDPSEFRPER
(3) QLPYLEAFILETFRHSSFVPFTIPHSTTR
3
P43477Dipeptidase 156745,096(1) VAVCTADQFRDNAVR
(2) VSKYPDLVAELLRRQWTEEEVRGALAENLLR
(3) QAPGEEPIPLGQLEASCR
3
Q6YNX6Calmodulin34516,838(1) VDADGNGTIDFPEFLTMMARKMKDT DSEEEIREAF
(2) VMTNLGEKLTDEEVDEMIR
(3) VDEMIR
3
P02190Myoglobin522 (1) VLNAWGKVEA DVAGHGQEVL IR
(2) VKYLEFISDAIIHVLHAKHPSDFGADAQGAMSKALELFR
(3) VFDKDGNGISAAELR
3
W5P481Collagen455140,644(1) VWKPVPCQICVCDNGNVLC DDVICDELKD CPNAKVPTPPR
(2) QDGRPGPPGPPGARGQAGVMGFPGPK
(3) V PGDLGAPGPSGARGER
3
P02446Keratins387 (1) VRTGPATTICSSDKFCR
(2) VYPDTYVPTCFLLNSSHPTPGLSGINLTTFIQPGCENVCEPR
(3) LSGINLTTFIQPGCENVCEPR
3

Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.


© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Richard the Lionheart and the Ferocious Saladin Face to Face in Arsuf: A Proteomic Study (2024)
Top Articles
Latest Posts
Article information

Author: Dr. Pierre Goyette

Last Updated:

Views: 6051

Rating: 5 / 5 (50 voted)

Reviews: 89% of readers found this page helpful

Author information

Name: Dr. Pierre Goyette

Birthday: 1998-01-29

Address: Apt. 611 3357 Yong Plain, West Audra, IL 70053

Phone: +5819954278378

Job: Construction Director

Hobby: Embroidery, Creative writing, Shopping, Driving, Stand-up comedy, Coffee roasting, Scrapbooking

Introduction: My name is Dr. Pierre Goyette, I am a enchanting, powerful, jolly, rich, graceful, colorful, zany person who loves writing and wants to share my knowledge and understanding with you.